Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Číst dál…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Riverside Hotel
Taxi · 8 min
Anhinga Trail
2h
Pěšky · 6 min
Corner Café
45 min
Pěšky · 18 min
Riverside Hotel

Anhinga Trail – Přidat do výletu

Vytvoř si podrobný cestovní itinerář s chytrým plánováním tras, odhady času a vším potřebným pro dokonalý výlet.

3M+ stažení · 4,6 hvězdičky · 15 let plánování výletů
QR code
Naskenuj a stáhni si aplikaci

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

Další informace a kontakt

Telefon +1 305 242 7700
Adresa (Unnamed Road), 33034, United States
Souřadnice 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Taxi · 8 min
Anhinga Trail
2h
Pěšky · 6 min
Corner Café
45 min
Pěšky · 18 min
Riverside Hotel

Anhinga Trail – Přidat do výletu

Vytvoř si podrobný cestovní itinerář s chytrým plánováním tras, odhady času a vším potřebným pro dokonalý výlet.

3M+ stažení · 4,6 hvězdičky · 15 let plánování výletů
QR code
Naskenuj a stáhni si aplikaci

Prozkoumej destinaci