Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Read more…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Anhinga Trail
Fredlyfish4
Anhinga Trail
Everglades NPS
Anhinga Trail
Fredlyfish4
Riverside Hotel
Taxi · 8 min
Anhinga Trail
2h
Walk · 6 min
Corner Café
45 min
Walk · 18 min
Riverside Hotel

Anhinga Trail – Add to Your Trip

Create a detailed travel itinerary with smart routing, time estimates, and everything you need for a perfect trip.

3M+ downloads · 4.6 stars · 15 years of trip planning
QR code
Scan to download the app

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

More Information and Contact

Phone +1 305 242 7700
Address (Unnamed Road), 33034, United States
Coordinates 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Taxi · 8 min
Anhinga Trail
2h
Walk · 6 min
Corner Café
45 min
Walk · 18 min
Riverside Hotel

Anhinga Trail – Add to Your Trip

Create a detailed travel itinerary with smart routing, time estimates, and everything you need for a perfect trip.

3M+ downloads · 4.6 stars · 15 years of trip planning
QR code
Scan to download the app

Explore the Destination