Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Tovább…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Riverside Hotel
Taxival · 8 min
Anhinga Trail
2h
Gyalog · 6 min
Corner Café
45 min
Gyalog · 18 min
Riverside Hotel

Anhinga Trail – Hozzáadás az utazáshoz

Készíts részletes útvonalat okos útvonaltervezéssel, időbecslésekkel és mindennel, ami a tökéletes utazáshoz szükséges.

Több mint 3 millió letöltés · 4,6 csillag · 15 év tapasztalat az utazástervezésben
QR code
Szkenneld be az app letöltéséhez

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

További információk és kapcsolat

Telefonszám +1 305 242 7700
Cím (Unnamed Road), 33034, United States
Koordináták 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Taxival · 8 min
Anhinga Trail
2h
Gyalog · 6 min
Corner Café
45 min
Gyalog · 18 min
Riverside Hotel

Anhinga Trail – Hozzáadás az utazáshoz

Készíts részletes útvonalat okos útvonaltervezéssel, időbecslésekkel és mindennel, ami a tökéletes utazáshoz szükséges.

Több mint 3 millió letöltés · 4,6 csillag · 15 év tapasztalat az utazástervezésben
QR code
Szkenneld be az app letöltéséhez

Fedezd fel az úti célt