Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Leggi di più…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Riverside Hotel
In taxi · 8 min
Anhinga Trail
2h
A piedi · 6 min
Corner Café
45 min
A piedi · 18 min
Riverside Hotel

Anhinga Trail – Aggiungi al tuo viaggio

Crea un itinerario di viaggio dettagliato con percorsi intelligenti, stime dei tempi e tutto ciò che serve per un viaggio perfetto.

Oltre 3 milioni di download · 4,6 stelle · 15 anni di pianificazione viaggi
QR code
Scansiona per scaricare l'app

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

Maggiori informazioni e contatti

Telefono +1 305 242 7700
Indirizzo (Unnamed Road), 33034, United States
Coordinate 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
In taxi · 8 min
Anhinga Trail
2h
A piedi · 6 min
Corner Café
45 min
A piedi · 18 min
Riverside Hotel

Anhinga Trail – Aggiungi al tuo viaggio

Crea un itinerario di viaggio dettagliato con percorsi intelligenti, stime dei tempi e tutto ciò che serve per un viaggio perfetto.

Oltre 3 milioni di download · 4,6 stelle · 15 anni di pianificazione viaggi
QR code
Scansiona per scaricare l'app

Esplora la destinazione