Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… 자세히 읽기…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
리버사이드 호텔
택시 · 8 min
Anhinga Trail
2h
도보 · 6 min
코너 카페
45 min
도보 · 18 min
리버사이드 호텔

Anhinga Trail – 여행에 추가

스마트 경로 안내, 소요 시간 예측 등 완벽한 여행에 필요한 모든 기능을 통해 상세한 여행 일정을 만들어 보세요.

300만 회 이상 다운로드 · 평점 4.6점 · 15년의 여행 계획 노하우
QR code
스캔하여 앱 다운로드하기

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

추가 정보 및 연락처

전화번호 +1 305 242 7700
주소 (Unnamed Road), 33034, United States
좌표 25°22'54.001" N, 80°36'34.999" W
리버사이드 호텔
택시 · 8 min
Anhinga Trail
2h
도보 · 6 min
코너 카페
45 min
도보 · 18 min
리버사이드 호텔

Anhinga Trail – 여행에 추가

스마트 경로 안내, 소요 시간 예측 등 완벽한 여행에 필요한 모든 기능을 통해 상세한 여행 일정을 만들어 보세요.

300만 회 이상 다운로드 · 평점 4.6점 · 15년의 여행 계획 노하우
QR code
스캔하여 앱 다운로드하기

목적지 둘러보기