Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Lees meer…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Riverside Hotel
Taxi · 8 min
Anhinga Trail
2h
Lopen · 6 min
Corner Café
45 min
Lopen · 18 min
Riverside Hotel

Anhinga Trail – Voeg toe aan je reis

Maak een gedetailleerde reisroute met slimme routes, tijdsinschattingen en alles wat je nodig hebt voor een perfecte reis.

Meer dan 3 miljoen downloads · 4,6 sterren · 15 jaar ervaring in reisplanning
QR code
Scan om de app te downloaden

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

Meer informatie en contact

Telefoon +1 305 242 7700
Adres (Unnamed Road), 33034, United States
Coördinaten 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Taxi · 8 min
Anhinga Trail
2h
Lopen · 6 min
Corner Café
45 min
Lopen · 18 min
Riverside Hotel

Anhinga Trail – Voeg toe aan je reis

Maak een gedetailleerde reisroute met slimme routes, tijdsinschattingen en alles wat je nodig hebt voor een perfecte reis.

Meer dan 3 miljoen downloads · 4,6 sterren · 15 jaar ervaring in reisplanning
QR code
Scan om de app te downloaden

Ontdek de bestemming