Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Czytaj więcej…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Riverside Hotel
Taksówka · 8 min
Anhinga Trail
2h
Pieszo · 6 min
Corner Café
45 min
Pieszo · 18 min
Riverside Hotel

Anhinga Trail – dodaj do wycieczki

Stwórz szczegółowy plan podróży z inteligentnym wyznaczaniem tras, szacowanym czasem i wszystkim, czego potrzebujesz do udanej wycieczki.

Ponad 3 mln pobrań · Ocena 4,6 · 15 lat w planowaniu podróży
QR code
Zeskanuj, aby pobrać aplikację

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

Więcej informacji i kontakt

Telefon +1 305 242 7700
Adres (Unnamed Road), 33034, United States
Współrzędne 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Taksówka · 8 min
Anhinga Trail
2h
Pieszo · 6 min
Corner Café
45 min
Pieszo · 18 min
Riverside Hotel

Anhinga Trail – dodaj do wycieczki

Stwórz szczegółowy plan podróży z inteligentnym wyznaczaniem tras, szacowanym czasem i wszystkim, czego potrzebujesz do udanej wycieczki.

Ponad 3 mln pobrań · Ocena 4,6 · 15 lat w planowaniu podróży
QR code
Zeskanuj, aby pobrać aplikację

Odkryj cel podróży