Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Ler mais…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Anhinga Trail
Fredlyfish4
Anhinga Trail
Everglades NPS
Anhinga Trail
Fredlyfish4
Riverside Hotel
Táxi · 8 min
Anhinga Trail
2h
A Pé · 6 min
Corner Café
45 min
A Pé · 18 min
Riverside Hotel

Anhinga Trail – Adicionar À Tua Viagem

Cria um itinerário de viagem detalhado com rotas inteligentes, estimativas de tempo e tudo o que precisas para uma viagem perfeita.

3M+ downloads · 4,6 estrelas · 15 anos a planear viagens
QR code
Digitaliza para descarregar a app

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

Mais Informações e Contacto

Telefone +1 305 242 7700
Endereço (Unnamed Road), 33034, United States
Coordenadas 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Táxi · 8 min
Anhinga Trail
2h
A Pé · 6 min
Corner Café
45 min
A Pé · 18 min
Riverside Hotel

Anhinga Trail – Adicionar À Tua Viagem

Cria um itinerário de viagem detalhado com rotas inteligentes, estimativas de tempo e tudo o que precisas para uma viagem perfeita.

3M+ downloads · 4,6 estrelas · 15 anos a planear viagens
QR code
Digitaliza para descarregar a app

Explorar o Destino