Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Читать далее…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Riverside Hotel
Такси · 8 min
Anhinga Trail
2h
Пешком · 6 min
Corner Café
45 min
Пешком · 18 min
Riverside Hotel

Anhinga Trail — добавь в свою поездку

Создай подробный маршрут с умным расчётом пути, оценкой времени и всем необходимым для идеальной поездки.

Более 3 млн скачиваний · 4.6 звезды · 15 лет опыта в планировании поездок
QR code
Отсканируй, чтобы скачать приложение

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

Дополнительная информация и контакты

Телефон +1 305 242 7700
Адрес (Unnamed Road), 33034, United States
Координаты 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Такси · 8 min
Anhinga Trail
2h
Пешком · 6 min
Corner Café
45 min
Пешком · 18 min
Riverside Hotel

Anhinga Trail — добавь в свою поездку

Создай подробный маршрут с умным расчётом пути, оценкой времени и всем необходимым для идеальной поездки.

Более 3 млн скачиваний · 4.6 звезды · 15 лет опыта в планировании поездок
QR code
Отсканируй, чтобы скачать приложение

Исследуй направление