Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Čítať viac…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Riverside Hotel
Taxi · 8 min
Anhinga Trail
2h
Pešo · 6 min
Corner Café
45 min
Pešo · 18 min
Riverside Hotel

Anhinga Trail – Pridať do výletu

Vytvor si podrobný cestovný itinerár s inteligentným plánovaním trás, časovými odhadmi a všetkým, čo potrebuješ na dokonalý výlet.

Viac ako 3 mil. stiahnutí · 4,6 hviezdičky · 15 rokov plánovania výletov
QR code
Naskenuj a stiahni si aplikáciu

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

Ďalšie informácie a kontakt

Telefón +1 305 242 7700
Adresa (Unnamed Road), 33034, United States
Súradnice 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Taxi · 8 min
Anhinga Trail
2h
Pešo · 6 min
Corner Café
45 min
Pešo · 18 min
Riverside Hotel

Anhinga Trail – Pridať do výletu

Vytvor si podrobný cestovný itinerár s inteligentným plánovaním trás, časovými odhadmi a všetkým, čo potrebuješ na dokonalý výlet.

Viac ako 3 mil. stiahnutí · 4,6 hviezdičky · 15 rokov plánovania výletov
QR code
Naskenuj a stiahni si aplikáciu

Preskúmaj destináciu