Tripomatic

Anhinga Trail

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm… Devamını oku…

animalswildlifewalkwaytrailnational parkhiking & camping
Anhinga Trail
Everglades NPS / Public domain
Anhinga Trail
Fredlyfish4
Anhinga Trail
Everglades NPS
Anhinga Trail
Fredlyfish4
Riverside Hotel
Taksi · 8 min
Anhinga Trail
2h
Yürüyüş · 6 min
Corner Café
45 min
Yürüyüş · 18 min
Riverside Hotel

Anhinga Trail – Geziye Ekle

Akıllı rotalar, süre tahminleri ve mükemmel bir gezi için ihtiyacın olan her şeyle ayrıntılı bir güzergah oluştur.

3M+ indirme · 4.6 yıldız · 15 yıllık gezi planlama deneyimi
QR code
Uygulamayı indirmek için tara

The Anhinga Trail is a short trail in the Everglades National Park. Located 4 miles from the park entrance, it starts at the Royal Palm Visitor Center. The trail is a paved walkway and a boardwalk over Taylor Slough, a freshwater sawgrass marsh. Abundant wildlife is visible from the trail, including alligators, turtles, anhingas, herons, and egrets. It is one of the most popular trails in the park. On November 5, 1996, it was added to the U.S. National Register of Historic Places.

In 2003, tourists witnessed a fight between an alligator and a Burmese python which went on for 24 hours, until a larger alligator joined the fight and the snake escaped. Video and news coverage of the fight was widespread and brought attention to the spread of the python, an invasive species, in the Everglades.

Source: Wikipedia

Daha Fazla Bilgi ve İletişim

Telefon +1 305 242 7700
Adres (Unnamed Road), 33034, United States
Koordinatlar 25°22'54.001" N, 80°36'34.999" W
Riverside Hotel
Taksi · 8 min
Anhinga Trail
2h
Yürüyüş · 6 min
Corner Café
45 min
Yürüyüş · 18 min
Riverside Hotel

Anhinga Trail – Geziye Ekle

Akıllı rotalar, süre tahminleri ve mükemmel bir gezi için ihtiyacın olan her şeyle ayrıntılı bir güzergah oluştur.

3M+ indirme · 4.6 yıldız · 15 yıllık gezi planlama deneyimi
QR code
Uygulamayı indirmek için tara

Varış Noktasını Keşfet